GPR154 Recombinant Protein Antigen

Images

 
There are currently no images for GPR154 Protein (NBP1-91966PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GPR154 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NPSR1.

Source: E. coli

Amino Acid Sequence: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NPSR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91966.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR154 Recombinant Protein Antigen

  • G protein-coupled receptor 154
  • G protein-coupled receptor for asthma susceptibility
  • GPR154NPSR
  • GPRAASRT2
  • G-protein coupled receptor 154
  • G-protein coupled receptor for asthma susceptibility
  • G-protein coupled receptor PGR14
  • neuropeptide S receptor 1
  • neuropeptide S receptor
  • PGR14VRR1
  • vasopressin receptor-related receptor 1

Background

The GPR154 gene codes a neuropeptide S receptor plasma membrane protein as it is part of the G protein-coupled receptor 1 family. The protein encoded by the GPR154 gene is active in signaling pathway in several tissues in a paracrine or autocrine fashion through mediation of inhibitory effects on cell growth. Nine isoforms of this protein exist: isoform 1: 371 amino acids long, 42 kDA; isoform 2: 305 amino acids long, 35 kDA; isoform 3: 390 amino acids long, 44 kDA; isoform 4: 377 amino acids long, 43 kDA; isoform 5: 366 amino acids long, 41 kDA; isoform 6: 158 amino acids long, 18 kDA; isoform 7: 136 amino acids long, 15 kDA; isoform 8: 143 amino acids long, 16 kDA; and isoform 9: 94 amino acids long, 10 kDA; It is known to be involved in the pathogenesis of asthma and other IgE-mediated diseases because of increased expression in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells. Research has investigated its role in asthma, panic disorder, dermatitis, rabies, eczema, inflammatory bowel disease, rheumatoid arthritis, schizophrenia, and attention deficit hyperactivity disorder as well. The GPR154 gene participates in GPCR downstream signaling and ligand binding through interactions with various genes such as: ADYC2, ADORA2A, ADORA2B, ADRB2, and AVPR1B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-47310
Species: Hu
Applications: ELISA, IHC
NBP3-38467
Species: Hu, Mu, Rt
Applications: ELISA, WB
AF2434
Species: Mu
Applications: IP, WB
NBP2-01249
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
NLS2576
Species: Hu, Pm, Rt
Applications: IHC,  IHC-P
NBP3-11412
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for GPR154 Protein (NBP1-91966PEP) (0)

There are no publications for GPR154 Protein (NBP1-91966PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR154 Protein (NBP1-91966PEP) (0)

There are no reviews for GPR154 Protein (NBP1-91966PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPR154 Protein (NBP1-91966PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR154 Products

Blogs on GPR154

There are no specific blogs for GPR154, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GPR154 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NPSR1