GPR154 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NPSR1. Source: E. coli
Amino Acid Sequence: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
NPSR1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91966. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GPR154 Recombinant Protein Antigen
Background
The GPR154 gene codes a neuropeptide S receptor plasma membrane protein as it is part of the G protein-coupled receptor 1 family. The protein encoded by the GPR154 gene is active in signaling pathway in several tissues in a paracrine or autocrine fashion through mediation of inhibitory effects on cell growth. Nine isoforms of this protein exist: isoform 1: 371 amino acids long, 42 kDA; isoform 2: 305 amino acids long, 35 kDA; isoform 3: 390 amino acids long, 44 kDA; isoform 4: 377 amino acids long, 43 kDA; isoform 5: 366 amino acids long, 41 kDA; isoform 6: 158 amino acids long, 18 kDA; isoform 7: 136 amino acids long, 15 kDA; isoform 8: 143 amino acids long, 16 kDA; and isoform 9: 94 amino acids long, 10 kDA; It is known to be involved in the pathogenesis of asthma and other IgE-mediated diseases because of increased expression in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells. Research has investigated its role in asthma, panic disorder, dermatitis, rabies, eczema, inflammatory bowel disease, rheumatoid arthritis, schizophrenia, and attention deficit hyperactivity disorder as well. The GPR154 gene participates in GPCR downstream signaling and ligand binding through interactions with various genes such as: ADYC2, ADORA2A, ADORA2B, ADRB2, and AVPR1B.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, IHC
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Pm, Rt
Applications: IHC, IHC-P
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for GPR154 Protein (NBP1-91966PEP) (0)
There are no publications for GPR154 Protein (NBP1-91966PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GPR154 Protein (NBP1-91966PEP) (0)
There are no reviews for GPR154 Protein (NBP1-91966PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GPR154 Protein (NBP1-91966PEP) (0)
Additional GPR154 Products
Blogs on GPR154