GPR154 Antibody - BSA Free

Immunohistochemistry-Paraffin: GPR154 Antibody [NBP1-91966] - Staining of human small intestine shows strong positivity in enteroendocrine cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GPR154 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPSR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
• Control Peptide:

  GPR154 Protein (NBP1-91966PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GPR154 Antibody - BSA Free

• G protein-coupled receptor 154
• G protein-coupled receptor for asthma susceptibility
• GPR154NPSR
• GPRAASRT2
• G-protein coupled receptor 154
• G-protein coupled receptor for asthma susceptibility
• G-protein coupled receptor PGR14
• neuropeptide S receptor 1
• neuropeptide S receptor
• PGR14VRR1
• vasopressin receptor-related receptor 1

Background

The GPR154 gene codes a neuropeptide S receptor plasma membrane protein as it is part of the G protein-coupled receptor 1 family. The protein encoded by the GPR154 gene is active in signaling pathway in several tissues in a paracrine or autocrine fashion through mediation of inhibitory effects on cell growth. Nine isoforms of this protein exist: isoform 1: 371 amino acids long, 42 kDA; isoform 2: 305 amino acids long, 35 kDA; isoform 3: 390 amino acids long, 44 kDA; isoform 4: 377 amino acids long, 43 kDA; isoform 5: 366 amino acids long, 41 kDA; isoform 6: 158 amino acids long, 18 kDA; isoform 7: 136 amino acids long, 15 kDA; isoform 8: 143 amino acids long, 16 kDA; and isoform 9: 94 amino acids long, 10 kDA; It is known to be involved in the pathogenesis of asthma and other IgE-mediated diseases because of increased expression in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells. Research has investigated its role in asthma, panic disorder, dermatitis, rabies, eczema, inflammatory bowel disease, rheumatoid arthritis, schizophrenia, and attention deficit hyperactivity disorder as well. The GPR154 gene participates in GPCR downstream signaling and ligand binding through interactions with various genes such as: ADYC2, ADORA2A, ADORA2B, ADRB2, and AVPR1B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GPR154 Antibody (NBP1-91966)(1)

Publication using NBP1-91966

• Camilleri M, Carlson P, Zinsmeister AR et al. Neuropeptide S receptor induces neuropeptide expression and associates with intermediate phenotypes of functional gastrointestinal disorders. Gastroenterology. 2010-01-01 [PMID: 19732772]

Bioinformatics

• Gene Symbol: NPSR1
• Entrez:
  • 387129(Human)
• Uniprot:
  • Q6W5P4(Human)