GPR154 Antibody

Images

 
Immunohistochemistry-Paraffin: GPR154 Antibody [NBP1-91966] - Staining of human small intestine shows strong positivity in enteroendocrine cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GPR154 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCRERRSQDSRMTFRERTERHEMQILSKP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPSR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Control Peptide
GPR154 Protein (NBP1-91966PEP)
Publications
Read Publication using NBP1-91966.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GPR154 Antibody

  • G protein-coupled receptor 154
  • G protein-coupled receptor for asthma susceptibility
  • GPR154NPSR
  • GPRAASRT2
  • G-protein coupled receptor 154
  • G-protein coupled receptor for asthma susceptibility
  • G-protein coupled receptor PGR14
  • neuropeptide S receptor 1
  • neuropeptide S receptor
  • PGR14VRR1
  • vasopressin receptor-related receptor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051131-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
MAB5565
Species: Hu
Applications: IP, CyTOF-ready, ICFlow
NBP2-01249
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NLS418
Species: Hu
Applications: IHC, IHC-P
NLS2756
Species: Hu, Pm
Applications: IHC, IHC-P, ICC
NLS442
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84903
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NLS2576
Species: Hu, Rt, Pm
Applications: IHC, IHC-P
NB7343
Species: Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-94035
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NB600-922
Species: Ch
Applications: WB, ELISA, IHC, IHC-P, IP, Single-Cell Western
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-91966
Species: Hu
Applications: IHC, IHC-P

Publications for GPR154 Antibody (NBP1-91966)(1)

Reviews for GPR154 Antibody (NBP1-91966) (0)

There are no reviews for GPR154 Antibody (NBP1-91966). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GPR154 Antibody (NBP1-91966) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GPR154 Products

Bioinformatics Tool for GPR154 Antibody (NBP1-91966)

Discover related pathways, diseases and genes to GPR154 Antibody (NBP1-91966). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GPR154 Antibody (NBP1-91966)

Discover more about diseases related to GPR154 Antibody (NBP1-91966).
 

Pathways for GPR154 Antibody (NBP1-91966)

View related products by pathway.

PTMs for GPR154 Antibody (NBP1-91966)

Learn more about PTMs related to GPR154 Antibody (NBP1-91966).

Blogs on GPR154

There are no specific blogs for GPR154, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GPR154 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPSR1
Entrez
Uniprot