GNB5 Recombinant Protein Antigen

Images

 
There are currently no images for GNB5 Recombinant Protein Antigen (NBP2-58164PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GNB5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GNB5.

Source: E. coli

Amino Acid Sequence: DNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GNB5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58164.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GNB5 Recombinant Protein Antigen

  • FLJ37457
  • FLJ43714
  • G protein, beta subunit 5L
  • G protein, beta-5 subunit
  • GB5
  • gbeta5
  • guanine nucleotide binding protein (G protein), beta 5
  • guanine nucleotide-binding protein subunit beta-5
  • guanine nucleotide-binding protein, beta subunit 5L
  • Transducin beta chain 5

Background

FUNCTION: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. SUBUNIT: G proteins are composed of 3 units, alpha, beta and gamma. Component of the RGS9-1-Gbeta5 complex composed of RGS9 (isoform RGS9-1), Gbeta5 (GNB5) and RGS9BP. TISSUE SPECIFICITY: Expressed in multiple tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-46743
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-58919
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-46123
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56659
Species: Hu, Mu, Rt
Applications: WB
NBP1-32521
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB100-56658
Species: Hu, Mu, Rt
Applications: WB
NBP2-48946
Species: Hu
Applications: IHC,  IHC-P
NLS418
Species: Hu
Applications: IHC,  IHC-P
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P
664-LI
Species: Hu
Applications: BA
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NBP2-58164PEP
Species: Hu
Applications: AC

Publications for GNB5 Recombinant Protein Antigen (NBP2-58164PEP) (0)

There are no publications for GNB5 Recombinant Protein Antigen (NBP2-58164PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNB5 Recombinant Protein Antigen (NBP2-58164PEP) (0)

There are no reviews for GNB5 Recombinant Protein Antigen (NBP2-58164PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GNB5 Recombinant Protein Antigen (NBP2-58164PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GNB5 Products

Research Areas for GNB5 Recombinant Protein Antigen (NBP2-58164PEP)

Find related products by research area.

Blogs on GNB5

There are no specific blogs for GNB5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GNB5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GNB5