glutamine rich 2 Antibody


Immunocytochemistry/ Immunofluorescence: glutamine rich 2 Antibody [NBP2-56731] - Staining of human cell line U-2 OS shows localization to nucleoplasm, nuclear membrane & vesicles.
Orthogonal Strategies: Immunohistochemistry-Paraffin: glutamine rich 2 Antibody [NBP2-56731] - Staining in human testis and endometrium tissues using anti-QRICH2 antibody. Corresponding QRICH2 RNA-seq data are more
Immunohistochemistry-Paraffin: glutamine rich 2 Antibody [NBP2-56731] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: glutamine rich 2 Antibody [NBP2-56731] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

glutamine rich 2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TAHPSDGVSSREQSKVPSGTGRQQQPRARDEAGVPRLHQSSTFQFKSDSDRHRSREKLTSTQPRRNARPGPVQQDLPLARDQPSSVPASQSQVHLR
Specificity of human glutamine rich 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for glutamine rich 2 Antibody

  • glutamine rich 2
  • glutamine-rich protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for glutamine rich 2 Antibody (NBP2-56731) (0)

There are no publications for glutamine rich 2 Antibody (NBP2-56731).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for glutamine rich 2 Antibody (NBP2-56731) (0)

There are no reviews for glutamine rich 2 Antibody (NBP2-56731). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for glutamine rich 2 Antibody (NBP2-56731) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional glutamine rich 2 Products

Bioinformatics Tool for glutamine rich 2 Antibody (NBP2-56731)

Discover related pathways, diseases and genes to glutamine rich 2 Antibody (NBP2-56731). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on glutamine rich 2

There are no specific blogs for glutamine rich 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our glutamine rich 2 Antibody and receive a gift card or discount.


Gene Symbol QRICH2