![Western Blot: C8orf47 Antibody [NBP1-93788] - Analysis in control (vector only transfected HEK293T lysate) and ERICH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/C8orf47-Antibody-Western-Blot-NBP1-93788-img0009.jpg "Western Blot: C8orf47 Antibody [NBP1-93788] - Analysis in control (vector only transfected HEK293T lysate) and ERICH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QPQGTVGKDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDRSQLVEK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C8orf47 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C8orf47 |
![Immunohistochemistry-Paraffin: C8orf47 Antibody [NBP1-93788] - Staining in human fallopian tube and cerebral cortex tissues using anti-ERICH5 antibody. Corresponding ERICH5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/C8orf47-Antibody-Immunohistochemistry-Paraffin-NBP1-93788-img0007.jpg "Immunohistochemistry-Paraffin: C8orf47 Antibody [NBP1-93788] - Staining in human fallopian tube and cerebral cortex tissues using anti-ERICH5 antibody. Corresponding ERICH5 RNA-seq data are presented for the same tissues.")
![Western Blot: C8orf47 Antibody [NBP1-93788] - Analysis in human cell line RT-4.](http://images.novusbio.com/fullsize2/C8orf47-Antibody-Western-Blot-NBP1-93788-img0008.jpg "Western Blot: C8orf47 Antibody [NBP1-93788] - Analysis in human cell line RT-4.")
![Immunohistochemistry-Paraffin: C8orf47 Antibody [NBP1-93788] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize2/C8orf47-Antibody-Immunohistochemistry-Paraffin-NBP1-93788-img0005.jpg "Immunohistochemistry-Paraffin: C8orf47 Antibody [NBP1-93788] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry-Paraffin: C8orf47 Antibody [NBP1-93788] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize2/C8orf47-Antibody-Immunohistochemistry-Paraffin-NBP1-93788-img0006.jpg "Immunohistochemistry-Paraffin: C8orf47 Antibody [NBP1-93788] - Staining of human fallopian tube shows high expression.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")