Glutamate Rich 4 Antibody

Immunocytochemistry/Immunofluorescence: C19orf69 Antibody [NBP2-30800] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.

Immunohistochemistry: C19orf69 Antibody [NBP2-30800] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Glutamate Rich 4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSETMELWRQLNQAGLVPPGLGPPPQALREVSPVEIPGQTLRTAGADTGGACDS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERICH4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Glutamate Rich 4 Recombinant Protein Antigen (NBP2-30800PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glutamate Rich 4 Antibody

• Chromosome 19 Open Reading Frame 69
• Uncharacterized Protein C19orf69

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERICH4
• Uniprot:
  • A6NGS2(Human)