GDPD3 Antibody - BSA Free

Western Blot: GDPD3 Antibody [NBP1-81081] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-BR-3

Immunocytochemistry/Immunofluorescence: GDPD3 Antibody [NBP1-81081] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytokinetic bridge. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GDPD3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GDPD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GDPD3 Protein (NBP1-81081PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GDPD3 Antibody - BSA Free

• EC 3.1
• FLJ22603
• glycerophosphodiester phosphodiesterase domain containing 3
• glycerophosphodiester phosphodiesterase domain-containing protein 3
• MGC4171

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GDPD3 Antibody (NBP1-81081)(1)

Publication using NBP1-81081

• Baras AS, Gandhi N, Munari E et al. Identification and Validation of Protein Biomarkers of Response to Neoadjuvant Platinum Chemotherapy in Muscle Invasive Urothelial Carcinoma. PLoS One 2015-01-01 [PMID: 26230923] (IF/IHC, Human)

FAQs for GDPD3 Antibody (NBP1-81081). (Showing 1 - 1 of 1 FAQ).

1. We are looking for anti-GDPD3 antibody for mouse. Could you please let us know whether we can use your Novus Biologicals NBP1-81081 for mice by FACS? Thank you so much.
   • We have unfortunately not tested our anti-GDPD3 (NBP1-81081) in mouse samples or for detection in FACS. The immunogen of this antibody is 87% homologous to the mouse sequence. Given this homology, there is a chance that this antibody could detect the mouse protein. If you would be interested in testing this novel species, please take a look at our Innovators Reward Program.

Bioinformatics

• Gene Symbol: GDPD3
• Entrez:
  • 79153(Human)