GDPD3 Antibody

Images

 
Western Blot: GDPD3 Antibody [NBP1-81081] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line SK-BR-3
Immunocytochemistry/ Immunofluorescence: GDPD3 Antibody [NBP1-81081] - Staining of human cell line MCF7 shows localization to nucleoplasm & cytokinetic bridge. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human urinary bladder shows strong cytoplasmic positivity in umbrella cells.
Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: GDPD3 Antibody [NBP1-81081] - Staining of human liver shows no positivity in hepatocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDPD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDPD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
IHC reported in scientific literature (PMID: 26230923). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GDPD3 Protein (NBP1-81081PEP)
Publications
Read Publication using
NBP1-81081 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (85%). Human reactivity reported in scientific literature (PMID: 26230923).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GDPD3 Antibody

  • EC 3.1
  • FLJ22603
  • glycerophosphodiester phosphodiesterase domain containing 3
  • glycerophosphodiester phosphodiesterase domain-containing protein 3
  • MGC4171

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GDPD3 Antibody (NBP1-81081)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GDPD3 Antibody (NBP1-81081) (0)

There are no reviews for GDPD3 Antibody (NBP1-81081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GDPD3 Antibody (NBP1-81081). (Showing 1 - 1 of 1 FAQ).

  1. We are looking for anti-GDPD3 antibody for mouse. Could you please let us know whether we can use your Novus Biologicals NBP1-81081 for mice by FACS? Thank you so much.
    • We have unfortunately not tested our anti-GDPD3 (NBP1-81081) in mouse samples or for detection in FACS. The immunogen of this antibody is 87% homologous to the mouse sequence. Given this homology, there is a chance that this antibody could detect the mouse protein. If you would be interested in testing this novel species, please take a look at our Innovators Reward Program.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GDPD3 Products

Array NBP1-81081

Bioinformatics Tool for GDPD3 Antibody (NBP1-81081)

Discover related pathways, diseases and genes to GDPD3 Antibody (NBP1-81081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for GDPD3 Antibody (NBP1-81081)

Find related products by research area.

Blogs on GDPD3

There are no specific blogs for GDPD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDPD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDPD3
Entrez