GDF5OS Antibody


Immunohistochemistry-Paraffin: GDF5OS Antibody [NBP2-32368] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

GDF5OS Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SSPSFSRALMSNTYLCFLTTGPRSSRENTQKSFPATSPRE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GDF5OS Protein (NBP2-32368PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GDF5OS Antibody

  • Growth Differentiation Factor 5 Opposite Strand
  • Growth/Differentiation Factor 5 Opposite Strand Transcript Protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GDF5OS Antibody (NBP2-32368) (0)

There are no publications for GDF5OS Antibody (NBP2-32368).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF5OS Antibody (NBP2-32368) (0)

There are no reviews for GDF5OS Antibody (NBP2-32368). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GDF5OS Antibody (NBP2-32368) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GDF5OS Products

GDF5OS NBP2-32368

Bioinformatics Tool for GDF5OS Antibody (NBP2-32368)

Discover related pathways, diseases and genes to GDF5OS Antibody (NBP2-32368). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GDF5OS

There are no specific blogs for GDF5OS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GDF5OS Antibody and receive a gift card or discount.


Gene Symbol GDF5OS