GATSL3 Antibody


Western Blot: GATSL3 Antibody [NBP3-17496] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10; Lane 2: RT4; Lane 3: U-251 MG; Lane 4: Human Plasma; Lane 5: Liver; Lane 6: Tonsil
Immunohistochemistry-Paraffin: GATSL3 Antibody [NBP3-17496] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

GATSL3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EQDLSVVIHTLAQEFDIYREVGGEPVPVTRDDSSNGFPRTQHGPSPTVHPIQSPQNRFCVLTLDPET
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for GATSL3 Antibody

  • GATS protein-like 3
  • GATS-like protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GATSL3 Antibody (NBP3-17496) (0)

There are no publications for GATSL3 Antibody (NBP3-17496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATSL3 Antibody (NBP3-17496) (0)

There are no reviews for GATSL3 Antibody (NBP3-17496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATSL3 Antibody (NBP3-17496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GATSL3 Products

Bioinformatics Tool for GATSL3 Antibody (NBP3-17496)

Discover related pathways, diseases and genes to GATSL3 Antibody (NBP3-17496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GATSL3

There are no specific blogs for GATSL3, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GATSL3 Antibody and receive a gift card or discount.


Gene Symbol GATSL3