GALNT12 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

GALNT12 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNT12
  
  

  Source: E.coli

  Amino Acid Sequence: VPEDRPGFFGMLQNKGLTDYCFDYNPPDENQIVGHQVILYLCHGMGQNQFF

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: GALNT12
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24860It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GALNT12 Recombinant Protein Antigen

• colorectal cancer, susceptibility to 1
• CRCS1
• EC 2.4.1.41
• FLJ21212
• GalNAc-T12
• GALNT12
• Polypeptide GalNAc transferase 12
• polypeptide N-acetylgalactosaminyltransferase 12
• Pp-GaNTase 12
• Protein-UDP acetylgalactosaminyltransferase 12
• UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase
• UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12
• UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 12 (GalNAc-T12)

Background

GALNT12, also known as Polypeptide N-acetylgalactosaminyltransferase 12, has a 581 amino acid long isoform that is 67 kDa and a short 272 amino acid isoform that is 32 kDa, plays role in catalyzing the initial reaction in O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; displays activity toward non-glycosylated peptides such as Muc5AC, Muc1a and EA2, Gal-NAc-Muc5AC glycopeptide; and initializes mucin-type oligosaccharide biosynthesis in digestive organs. Studies on this protein have shown a relationship with the following disorders and diseases: colorectal cancer, colon cancer, cerebritis, thyroiditis, and prostatitis. This protein has also been shown to have interactions with MUC7, MUC1, MUC2, MUC5AC, and C1GALT1 in the pathways such as the O-linked glycosylation of mucins, metabolism of proteins, post-translational protein modification, and mucin type O-Glycan biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GALNT12