GALNT12 Recombinant Protein Antigen

Images

 
There are currently no images for GALNT12 Recombinant Protein Antigen (NBP3-24860PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GALNT12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNT12

Source: E.coli

Amino Acid Sequence: VPEDRPGFFGMLQNKGLTDYCFDYNPPDENQIVGHQVILYLCHGMGQNQFF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GALNT12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24860It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GALNT12 Recombinant Protein Antigen

  • colorectal cancer, susceptibility to 1
  • CRCS1
  • EC 2.4.1.41
  • FLJ21212
  • GalNAc-T12
  • GALNT12
  • Polypeptide GalNAc transferase 12
  • polypeptide N-acetylgalactosaminyltransferase 12
  • Pp-GaNTase 12
  • Protein-UDP acetylgalactosaminyltransferase 12
  • UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferase
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 12
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 12 (GalNAc-T12)

Background

GALNT12, also known as Polypeptide N-acetylgalactosaminyltransferase 12, has a 581 amino acid long isoform that is 67 kDa and a short 272 amino acid isoform that is 32 kDa, plays role in catalyzing the initial reaction in O-linked oligosaccharide biosynthesis, and the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor; displays activity toward non-glycosylated peptides such as Muc5AC, Muc1a and EA2, Gal-NAc-Muc5AC glycopeptide; and initializes mucin-type oligosaccharide biosynthesis in digestive organs. Studies on this protein have shown a relationship with the following disorders and diseases: colorectal cancer, colon cancer, cerebritis, thyroiditis, and prostatitis. This protein has also been shown to have interactions with MUC7, MUC1, MUC2, MUC5AC, and C1GALT1 in the pathways such as the O-linked glycosylation of mucins, metabolism of proteins, post-translational protein modification, and mucin type O-Glycan biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46157
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
H00022927-D01P
Species: Hu
Applications: ICC/IF, WB
354-BP
Species: Hu
Applications: BA
NBP2-57949
Species: Hu
Applications: ICC/IF
NBP3-12326
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
930-ADB
Species: Hu
Applications: EnzAct
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-24860PEP
Species: Hu
Applications: AC

Publications for GALNT12 Recombinant Protein Antigen (NBP3-24860PEP) (0)

There are no publications for GALNT12 Recombinant Protein Antigen (NBP3-24860PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT12 Recombinant Protein Antigen (NBP3-24860PEP) (0)

There are no reviews for GALNT12 Recombinant Protein Antigen (NBP3-24860PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GALNT12 Recombinant Protein Antigen (NBP3-24860PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GALNT12 Products

Research Areas for GALNT12 Recombinant Protein Antigen (NBP3-24860PEP)

Find related products by research area.

Blogs on GALNT12

There are no specific blogs for GALNT12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MUC5AC Antibody (45M1)
NBP2-15196-0.1mg

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GALNT12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT12