FSTL5 Antibody

Images

 
Western Blot: FSTL5 Antibody [NBP2-14028] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: FSTL5 Antibody [NBP2-14028] - Staining of human kidney shows strong cytoplasmic positivity in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FSTL5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSEKLLGFQDEVCPKAEGDE VQRCVWASAVNVKDKFIYVAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FSTL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FSTL5 Protein (NBP2-14028PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FSTL5 Antibody

  • Follistatin like 5
  • Follistatin-like 5
  • Follistatin-like protein 5
  • follistatin-related protein 5
  • FSL5
  • FSTL5
  • KIAA1263DKFZp566D234

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2299
Species: Mu
Applications: WB, IHC
NBP1-84615
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NB300-206
Species: Hu, Mu, Rt, Ba
Applications: WB, IHC, IP
NBP1-22444
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for FSTL5 Antibody (NBP2-14028) (0)

There are no publications for FSTL5 Antibody (NBP2-14028).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSTL5 Antibody (NBP2-14028) (0)

There are no reviews for FSTL5 Antibody (NBP2-14028). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FSTL5 Antibody (NBP2-14028) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FSTL5 Products

Bioinformatics Tool for FSTL5 Antibody (NBP2-14028)

Discover related pathways, diseases and genes to FSTL5 Antibody (NBP2-14028). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FSTL5 Antibody (NBP2-14028)

Discover more about diseases related to FSTL5 Antibody (NBP2-14028).

Blogs on FSTL5

There are no specific blogs for FSTL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FSTL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FSTL5
Entrez