FRMD8 Antibody

Images

 
Western Blot: FRMD8 Antibody [NBP1-83884] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: FRMD8 Antibody [NBP1-83884] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FRMD8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FRMD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FRMD8 Protein (NBP1-83884PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-83884 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FRMD8 Antibody

  • FERM domain containing 8
  • FERM domain-containing protein 8
  • FKSG44
  • FLJ32216
  • FLJ90369
  • MGC31785

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FRMD8 Antibody (NBP1-83884) (0)

There are no publications for FRMD8 Antibody (NBP1-83884).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for FRMD8 Antibody (NBP1-83884) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-83884:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot FRMD8 NBP1-83884
Enlarge
reviewed by:
Anonymous
WB Human 02/26/2017
View

Summary

ApplicationWestern Blot
Sample TestedHEK293T cells
SpeciesHuman
LotR04034

Comments

CommentsThe antibody works well for overexpressed FRMD8 in Western Blot. I recommend to use a dilution of 1:250 - 1:500 for the detection of overexpressed FRMD8 by Western Blot.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FRMD8 Antibody (NBP1-83884) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FRMD8 Products

Bioinformatics Tool for FRMD8 Antibody (NBP1-83884)

Discover related pathways, diseases and genes to FRMD8 Antibody (NBP1-83884). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FRMD8

There are no specific blogs for FRMD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
02/26/2017
Application: WB
Species: Human

Bioinformatics

Gene Symbol FRMD8