FMO9P Antibody

Images

 
Western Blot: FMO9P Antibody [H00116123-B01P] - Analysis of FMO9P expression in transfected 293T cell line by FMO9P polyclonal antibody. Lane 1: LOC116123 transfected lysate(17.6 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FMO9P Antibody Summary

Immunogen
FMO9P (AAH14341.1, 1 a.a. - 160 a.a.) full-length human protein. MPSIYKSVTINTSKEMMCFSDFPVPDHFPNYMHNSKLMDYFGMYATHFGLLNYIRFKTEVQSVRKHPDFSINGQWDVVVETEEKQETLVFDGVLVCSGHHTDPYLPLQSFPGIEKFEGCYFHSREYKSPEDFSGKRIIVIGIGNSGVDIAVELSRVAKQI
Specificity
FMO9P - flavin containing monooxygenase 9 pseudogene,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FMO9P
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FMO9P Antibody

  • flavin containing monooxygenase 9 pseudogene
  • MGC23941

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16512
Species: Hu
Applications: WB, IHC, IHC-P
H00116123-B01P
Species: Hu
Applications: WB

Publications for FMO9P Antibody (H00116123-B01P) (0)

There are no publications for FMO9P Antibody (H00116123-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMO9P Antibody (H00116123-B01P) (0)

There are no reviews for FMO9P Antibody (H00116123-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FMO9P Antibody (H00116123-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FMO9P Products

Array H00116123-B01P

Bioinformatics Tool for FMO9P Antibody (H00116123-B01P)

Discover related pathways, diseases and genes to FMO9P Antibody (H00116123-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FMO9P

There are no specific blogs for FMO9P, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FMO9P Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FMO9P
Entrez