FLJ23584 Antibody (NBP2-31018)

Images

 
Immunocytochemistry/ Immunofluorescence: FLJ23584 Antibody [NBP2-31018] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus & nucleoli.
Immunohistochemistry: FLJ23584 Antibody [NBP2-31018] - Staining of human cerebellum shows moderate nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FLJ23584 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VHTHSEPIFCTTSISNTCLLPQNSSWKAWQVPWCLHDGQTRPALDMCQEMEQLLLHSQERLVSLEPVISVRSRPTSMTLTTSLPNL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C22ORF46
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
FLJ23584 Protein (NBP2-31018PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FLJ23584 Antibody

  • chromosome 22 open reading frame 46
  • CTA-216E10.6
  • FLJ23584

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLJ23584 Antibody (NBP2-31018) (0)

There are no publications for FLJ23584 Antibody (NBP2-31018).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ23584 Antibody (NBP2-31018) (0)

There are no reviews for FLJ23584 Antibody (NBP2-31018). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FLJ23584 Antibody (NBP2-31018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLJ23584 Products

Bioinformatics Tool for FLJ23584 Antibody (NBP2-31018)

Discover related pathways, diseases and genes to FLJ23584 Antibody (NBP2-31018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FLJ23584

There are no specific blogs for FLJ23584, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ23584 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C22ORF46
Uniprot