FLJ13946 Antibody


Immunocytochemistry/ Immunofluorescence: TTC30B Antibody [NBP2-46805] - Staining of human cell line SH-SY5Y shows localization to nucleus.
Immunohistochemistry: TTC30B Antibody [NBP2-46805] - Staining of human fallopian tube shows distinct positivity in cilia.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

FLJ13946 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEA
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FLJ13946 Recombinant Protein Antigen (NBP2-46805PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FLJ13946 Antibody

  • FLJ13946
  • FLJ77601
  • IFT70A
  • tetratricopeptide repeat domain 30A
  • tetratricopeptide repeat protein 30A
  • TPR repeat protein 30A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLJ13946 Antibody (NBP2-46805) (0)

There are no publications for FLJ13946 Antibody (NBP2-46805).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ13946 Antibody (NBP2-46805) (0)

There are no reviews for FLJ13946 Antibody (NBP2-46805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FLJ13946 Antibody (NBP2-46805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FLJ13946 Products

Bioinformatics Tool for FLJ13946 Antibody (NBP2-46805)

Discover related pathways, diseases and genes to FLJ13946 Antibody (NBP2-46805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FLJ13946

There are no specific blogs for FLJ13946, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FLJ13946 Antibody and receive a gift card or discount.


Gene Symbol TTC30A