FLJ11184 Antibody


Immunocytochemistry/ Immunofluorescence: FLJ11184 Antibody [NBP2-55828] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

FLJ11184 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KALRLNLVGEKLQWFQNHLDPQKKRYSKKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQTMER
Specificity of human FLJ11184 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FLJ11184 Recombinant Protein Antigen (NBP2-55828PEP)

Reactivity Notes

Mouse 82%, Rat 84%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FLJ11184 Antibody

  • chromosome 4 open reading frame 43
  • FLJ11184
  • FLJ52950
  • hypothetical protein LOC55319


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLJ11184 Antibody (NBP2-55828) (0)

There are no publications for FLJ11184 Antibody (NBP2-55828).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ11184 Antibody (NBP2-55828) (0)

There are no reviews for FLJ11184 Antibody (NBP2-55828). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FLJ11184 Antibody (NBP2-55828) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FLJ11184 Products

Bioinformatics Tool for FLJ11184 Antibody (NBP2-55828)

Discover related pathways, diseases and genes to FLJ11184 Antibody (NBP2-55828). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for FLJ11184 Antibody (NBP2-55828)

Find related products by research area.

Blogs on FLJ11184

There are no specific blogs for FLJ11184, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FLJ11184 Antibody and receive a gift card or discount.


Gene Symbol TMA16