FHAD1 Antibody


Immunohistochemistry-Paraffin: FHAD1 Antibody [NBP2-14780] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: FHAD1 Antibody [NBP2-14780] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells
Immunohistochemistry-Paraffin: FHAD1 Antibody [NBP2-14780] - Staining of human fallopian tube shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FHAD1 Antibody [NBP2-14780] - Staining in human fallopian tube and placenta tissues using anti-FHAD1 antibody. Corresponding FHAD1 RNA-seq data are presented ...read more

Product Details

Reactivity HuSpecies Glossary
Applications IHC
Validated by:

Orthogonal Strategies


Order Details

FHAD1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the amino acids: LQEMGNRESVIKINLERAVGQLEHFRSQVIKATYGRAKPFRDKPVTDQQLIEKITQVTEDNINFQQKKWTLQKETQLSNSKQ
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FHAD1 Protein (NBP2-14780PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FHAD1 Antibody

  • FHAD1 forkhead-associated (FHA) phosphopeptide binding domain 1
  • RP3-467K16.1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FHAD1 Antibody (NBP2-14780) (0)

There are no publications for FHAD1 Antibody (NBP2-14780).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHAD1 Antibody (NBP2-14780) (0)

There are no reviews for FHAD1 Antibody (NBP2-14780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FHAD1 Antibody (NBP2-14780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FHAD1 Antibody and receive a gift card or discount.


Gene Symbol FHAD1