FBXO41 Antibody


Immunocytochemistry/ Immunofluorescence: FBXO41 Antibody [NBP2-58465] - Staining of human cell line SiHa shows localization to nucleus, plasma membrane & cytosol.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

FBXO41 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ARREVFESTSFQGKEQAAGPSPAAPHLLHHHHHHAPLAHFPGDLVPASLPCEELAEPGLVPAAAARYALREIEIPLGELFARKSVAS
Specificity of human FBXO41 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (95%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FBXO41 Recombinant Protein Antigen (NBP2-58465PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FBXO41 Antibody

  • F-box only protein 41
  • F-box protein 41


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXO41 Antibody (NBP2-58465) (0)

There are no publications for FBXO41 Antibody (NBP2-58465).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO41 Antibody (NBP2-58465) (0)

There are no reviews for FBXO41 Antibody (NBP2-58465). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FBXO41 Antibody (NBP2-58465) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FBXO41 Products

Bioinformatics Tool for FBXO41 Antibody (NBP2-58465)

Discover related pathways, diseases and genes to FBXO41 Antibody (NBP2-58465). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FBXO41

There are no specific blogs for FBXO41, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FBXO41 Antibody and receive a gift card or discount.


Gene Symbol FBXO41