FBXL16 Antibody - BSA Free

Immunohistochemistry-Paraffin: FBXL16 Antibody [NBP1-88440] - Analysis in human cerebral cortex and endometrium tissues. Corresponding FBXL16 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FBXL16 Antibody [NBP1-88440] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: FBXL16 Antibody [NBP1-88440] - Staining of human caudate nucleus shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FBXL16 Antibody [NBP1-88440] - Staining of human cerebral cortex, endometrium, liver and skin using Anti-FBXL16 antibody NBP1-88440 (A) shows similar protein distribution across tissues to independent antibody NBP2-38789 (B).

Immunohistochemistry-Paraffin: FBXL16 Antibody [NBP1-88440] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: FBXL16 Antibody [NBP1-88440] - Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human skin shows no positivity in squamous epithelial cells as expected.

Analysis in control (vector only transfected HEK293T lysate) and FBXL16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FBXL16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FBXL16 Antibody - BSA Free (NBP1-88440) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKA
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXL16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FBXL16 Protein (NBP1-88440PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBXL16 Antibody - BSA Free

• C16orf22
• c380A1.1 (novel protein)
• c380A1.1
• chromosome 16 open reading frame 22
• FBL16
• F-box and leucine-rich repeat protein 16Fbl16
• F-box/LRR-repeat protein 16
• FLJ33735
• MGC33974

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for FBXL16 Antibody (NBP1-88440). (Showing 1 - of FAQ).

Bioinformatics

• Gene Symbol: FBXL16