FBXL13 Recombinant Protein Antigen

Images

 
There are currently no images for FBXL13 Protein (NBP2-31664PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FBXL13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBXL13.

Source: E. coli

Amino Acid Sequence: GNKRVTDASFKFIDKNYPNLSHIYMADCKGITDSSLRSLSPLKQLTVLNLANCVRIGDMGLKQFLDGPASMRIRELNLSNCV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FBXL13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31664.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FBXL13 Recombinant Protein Antigen

  • FBL13
  • F-box and leucine-rich repeat protein 13Fbl13
  • F-box/LRR-repeat protein 13
  • FLJ38068
  • MGC21636

Background

FBXL13, also known as F-Box and Leucine-Rich Repeat Protein 13, contains a 84 kDa, 81 kDa, 79 kDa, and 53 kDa isoform, and is a part of the SCF-type E3 ubiquitin ligase complex, though its specific function within the complex is unknown. FBXL13 is not currently being used in disease research. The protein is not linked to any pathways or biological processes, but has been found to interact with AGO1, ATP5C1, DHX15, DHX30, and DHX36.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88248
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-81128
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-55529
Species: Hu
Applications: WB
NBP1-87049
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3820
Species: Mu
Applications: IHC, WB
NBP2-31664PEP
Species: Hu
Applications: AC

Publications for FBXL13 Protein (NBP2-31664PEP) (0)

There are no publications for FBXL13 Protein (NBP2-31664PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL13 Protein (NBP2-31664PEP) (0)

There are no reviews for FBXL13 Protein (NBP2-31664PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FBXL13 Protein (NBP2-31664PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL13 Products

Array NBP2-31664PEP

Blogs on FBXL13

There are no specific blogs for FBXL13, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FBXL13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL13