FAM89B Antibody

Images

 
Immunohistochemistry-Paraffin: FAM89B Antibody [NBP2-14008] Staining of human kidney shows moderate cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM89B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKEMLWGLYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM89B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM89B Protein (NBP2-14008PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM89B Antibody

  • family with sequence similarity 89, member B
  • mammary tumor virus receptor homolog 1
  • MTVR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44179
Species: Mu
Applications: WB, ELISA
NBP2-03263
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NBP2-14008
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for FAM89B Antibody (NBP2-14008) (0)

There are no publications for FAM89B Antibody (NBP2-14008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM89B Antibody (NBP2-14008) (0)

There are no reviews for FAM89B Antibody (NBP2-14008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM89B Antibody (NBP2-14008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM89B Products

Bioinformatics Tool for FAM89B Antibody (NBP2-14008)

Discover related pathways, diseases and genes to FAM89B Antibody (NBP2-14008). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM89B Antibody (NBP2-14008)

Discover more about diseases related to FAM89B Antibody (NBP2-14008).
 

Pathways for FAM89B Antibody (NBP2-14008)

View related products by pathway.

Blogs on FAM89B

There are no specific blogs for FAM89B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM89B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM89B