FAM83G Antibody

Images

 
Immunohistochemistry-Paraffin: FAM83G Antibody [NBP1-93772] - Staining of human skin shows high expression.
Immunohistochemistry: FAM83G Antibody [NBP1-93772] - Staining of human pancreas shows distinct membranous positivity in exocrine cells.
Immunohistochemistry-Paraffin: FAM83G Antibody [NBP1-93772] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: FAM83G Antibody [NBP1-93772] - Staining in human skin and skeletal muscle tissues using anti-FAM83G antibody. Corresponding FAM83G RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM83G Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AQRSTDKEAQGQQFHHHRVPASGTRDKDGFPGPPRYRSAADSVQSSTRNAGPAMAGPHHWQAKGGQ
Specificity
Specificity of human FAM83G antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM83G
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM83G Protein (NBP1-93772PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM83G Antibody

  • family with sequence similarity 83, member G
  • FLJ41564

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM83G Antibody (NBP1-93772) (0)

There are no publications for FAM83G Antibody (NBP1-93772).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM83G Antibody (NBP1-93772) (0)

There are no reviews for FAM83G Antibody (NBP1-93772). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM83G Antibody (NBP1-93772) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM83G Products

Bioinformatics Tool for FAM83G Antibody (NBP1-93772)

Discover related pathways, diseases and genes to FAM83G Antibody (NBP1-93772). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM83G

There are no specific blogs for FAM83G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM83G Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM83G