FAM83F Antibody


Immunocytochemistry/ Immunofluorescence: FAM83F Antibody [NBP2-56616] - Staining of human cell line CACO-2 shows localization to mitochondria.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

FAM83F Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SYRFTWSSSHVDRNLLLLLTGQNVEPFDTEFRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLIN
Specificity of human FAM83F antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM83F Recombinant Protein Antigen (NBP2-56616PEP)

Reactivity Notes

Mouse 82%, Rat 85%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FAM83F Antibody

  • family with sequence similarity 83, member F
  • hypothetical protein LOC113828


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM83F Antibody (NBP2-56616) (0)

There are no publications for FAM83F Antibody (NBP2-56616).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM83F Antibody (NBP2-56616) (0)

There are no reviews for FAM83F Antibody (NBP2-56616). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM83F Antibody (NBP2-56616) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for FAM83F Antibody (NBP2-56616)

Discover related pathways, diseases and genes to FAM83F Antibody (NBP2-56616). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM83F

There are no specific blogs for FAM83F, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM83F Antibody and receive a gift card or discount.


Gene Symbol FAM83F