FAM83E Antibody


Immunohistochemistry-Paraffin: FAM83E Antibody [NBP2-14004] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FAM83E Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VPVYLLLDRQQLPAFLELAQQLGVNPWNTENVDVRVVRGCSFQSRWRRQV SGTVREKFVLLDGERVISGSYS
Specificity of human FAM83E antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM83E Protein (NBP2-14004PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM83E Antibody

  • family with sequence similarity 83, member E
  • FLJ20200
  • hypothetical protein LOC54854
  • MGC138175
  • MGC138177


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM83E Antibody (NBP2-14004) (0)

There are no publications for FAM83E Antibody (NBP2-14004).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM83E Antibody (NBP2-14004) (0)

There are no reviews for FAM83E Antibody (NBP2-14004). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM83E Antibody (NBP2-14004) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM83E Products

FAM83E NBP2-14004

Bioinformatics Tool for FAM83E Antibody (NBP2-14004)

Discover related pathways, diseases and genes to FAM83E Antibody (NBP2-14004). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM83E

There are no specific blogs for FAM83E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM83E Antibody and receive a gift card or discount.


Gene Symbol FAM83E