FAM55D Antibody


Immunocytochemistry/ Immunofluorescence: FAM55D Antibody [NBP1-88548] - Staining of human cell line U-251 MG shows positivity in mitochondria.
Immunohistochemistry-Paraffin: FAM55D Antibody [NBP1-88548] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

FAM55D Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:LSKQEKSLFERSNVGVEIMEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
FAM55D Protein (NBP1-88548PEP)

Alternate Names for FAM55D Antibody

  • C11orf33
  • chromosome 11 open reading frame 33
  • family with sequence similarity 55, member D
  • FLJ20127
  • hypothetical protein LOC54827


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM55D Antibody (NBP1-88548) (0)

There are no publications for FAM55D Antibody (NBP1-88548).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM55D Antibody (NBP1-88548) (0)

There are no reviews for FAM55D Antibody (NBP1-88548). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM55D Antibody (NBP1-88548) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM55D Antibody Products

FAM55D NBP1-88548

Bioinformatics Tool for FAM55D Antibody (NBP1-88548)

Discover related pathways, diseases and genes to FAM55D Antibody (NBP1-88548). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM55D

There are no specific blogs for FAM55D, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our FAM55D Antibody and receive a gift card or discount.


Gene Symbol NXPE4

Customers Who Bought This Also Bought