FAM47E Antibody


Immunohistochemistry: FAM47E Antibody [NBP2-30745] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules and cells in glomeruli.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FAM47E Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PHKMDLLHENGPRPGLHENVCKAVSDFCKWVTTFGISDIDEEFILKQFDIDYETKPSHDALHTMKLNQVPLELKRSVGLSK
Specificity of human FAM47E antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM47E Protein (NBP2-30745PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM47E Antibody

  • Family With Sequence Similarity 47, Member E
  • Protein FAM47E
  • Similar To Genethonin 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM47E Antibody (NBP2-30745) (0)

There are no publications for FAM47E Antibody (NBP2-30745).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM47E Antibody (NBP2-30745) (0)

There are no reviews for FAM47E Antibody (NBP2-30745). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM47E Antibody (NBP2-30745) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM47E Products

FAM47E NBP2-30745

Bioinformatics Tool for FAM47E Antibody (NBP2-30745)

Discover related pathways, diseases and genes to FAM47E Antibody (NBP2-30745). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM47E

There are no specific blogs for FAM47E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM47E Antibody and receive a gift card or discount.


Gene Symbol FAM47E