FAM43B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM43B Antibody [NBP2-14709] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: FAM43B Antibody [NBP2-14709] - Staining of human hippocampus shows strong cytoplasmic positivity in astrocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM43B Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: PWRRNKFVLVEDEAKCKAKSLSPGLAYTSLLSSFLRSCPDLLPDWPLERLGRVFRSRRQKVELNKEDPTYTVWY
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM43B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM43B Protein (NBP2-14709PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM43B Antibody

  • FAM43B family with sequence similarity 43, member B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM43B Antibody (NBP2-14709) (0)

There are no publications for FAM43B Antibody (NBP2-14709).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM43B Antibody (NBP2-14709) (0)

There are no reviews for FAM43B Antibody (NBP2-14709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM43B Antibody (NBP2-14709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM43B Products

Diseases for FAM43B Antibody (NBP2-14709)

Discover more about diseases related to FAM43B Antibody (NBP2-14709).
 

Pathways for FAM43B Antibody (NBP2-14709)

View related products by pathway.

PTMs for FAM43B Antibody (NBP2-14709)

Learn more about PTMs related to FAM43B Antibody (NBP2-14709).

Blogs on FAM43B

There are no specific blogs for FAM43B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM43B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM43B