FAM241B Antibody


Immunohistochemistry-Paraffin: C10orf35 Antibody [NBP1-86317] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: C10orf35 Antibody [NBP1-86317] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Orthogonal Strategies: Immunohistochemistry-Paraffin: C10orf35 Antibody [NBP1-86317] - Staining in human cerebral cortex and liver tissues using anti-C10orf35 antibody. Corresponding C10orf35 RNA-seq data are ...read more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

FAM241B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRMVRILANGEIVQDDDPRVRTTTQ
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM241B Recombinant Protein Antigen (NBP1-86317PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM241B Antibody

  • C10orf35
  • chromosome 10 open reading frame 35
  • hypothetical protein LOC219738


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM241B Antibody (NBP1-86317) (0)

There are no publications for FAM241B Antibody (NBP1-86317).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM241B Antibody (NBP1-86317) (0)

There are no reviews for FAM241B Antibody (NBP1-86317). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM241B Antibody (NBP1-86317) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM241B Products

Bioinformatics Tool for FAM241B Antibody (NBP1-86317)

Discover related pathways, diseases and genes to FAM241B Antibody (NBP1-86317). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM241B

There are no specific blogs for FAM241B, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM241B Antibody and receive a gift card or discount.


Gene Symbol C10ORF35