FAM221A Antibody

Images

 
Independent Antibodies: Western Blot: C7orf46 Antibody [NBP1-90513] - Analysis using Anti-FAM221A antibody NBP1-90513 (A) shows similar pattern to independent antibody NBP1-90514 (B).
Immunocytochemistry/ Immunofluorescence: C7orf46 Antibody [NBP1-90513] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Orthogonal Strategies: Immunohistochemistry-Paraffin: C7orf46 Antibody [NBP1-90513] - Staining in human testis and endometrium tissues using anti-FAM221A antibody. Corresponding FAM221A RNA-seq data are presented ...read more
Immunocytochemistry/ Immunofluorescence: C7orf46 Antibody [NBP1-90513] - Staining of human cell line U-251MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: C7orf46 Antibody [NBP1-90513] - Staining of human cerebral cortex shows strong cytoplasmic positivity in astrocytes.
Immunohistochemistry-Paraffin: C7orf46 Antibody [NBP1-90513] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: C7orf46 Antibody [NBP1-90513] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM221A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MERLTLPLGGAAAVDEYLEYRRIVGEDDGGKLFTPEEYEEYKRKVLPLRLQNRLFVSWRSPTGMDCKLVGPET
Specificity
Specificity of human C7orf46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM221A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM221A Antibody

  • C7orf46
  • chromosome 7 open reading frame 46
  • family with sequence similarity 221, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM221A Antibody (NBP1-90513) (0)

There are no publications for FAM221A Antibody (NBP1-90513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM221A Antibody (NBP1-90513) (0)

There are no reviews for FAM221A Antibody (NBP1-90513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM221A Antibody (NBP1-90513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM221A Products

Bioinformatics Tool for FAM221A Antibody (NBP1-90513)

Discover related pathways, diseases and genes to FAM221A Antibody (NBP1-90513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM221A

There are no specific blogs for FAM221A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM221A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM221A