FAM212B Antibody


Western Blot: FAM212B Antibody [NBP1-93888] - Analysis in control (vector only transfected HEK293T lysate) and FAM212B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: FAM212B Antibody [NBP1-93888] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

FAM212B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EHPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHRSVCGRDLAPLPRTQPHQSCAQQGPERVEPDDWTSTLMSR
Specificity of human FAM212B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM212B Antibody

  • C1orf183
  • family with sequence similarity 212, member B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM212B Antibody (NBP1-93888) (0)

There are no publications for FAM212B Antibody (NBP1-93888).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM212B Antibody (NBP1-93888) (0)

There are no reviews for FAM212B Antibody (NBP1-93888). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM212B Antibody (NBP1-93888) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM212B Products

Bioinformatics Tool for FAM212B Antibody (NBP1-93888)

Discover related pathways, diseases and genes to FAM212B Antibody (NBP1-93888). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM212B

There are no specific blogs for FAM212B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM212B Antibody and receive a gift card or discount.


Gene Symbol FAM212B