FAM211A Antibody


Western Blot: FAM211A Antibody [NBP1-93828] - Analysis in control (vector only transfected HEK293T lysate) and LRRC75A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry: FAM211A Antibody [NBP1-93828] - Immunohistochemical staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

FAM211A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GMVQELLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKP
Specificity of human FAM211A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM211A Protein (NBP1-93828PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM211A Antibody

  • C17orf76
  • chromosome 17 open reading frame 76
  • FLJ35696
  • leucine-rich repeat-containing protein C17orf76


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM211A Antibody (NBP1-93828) (0)

There are no publications for FAM211A Antibody (NBP1-93828).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM211A Antibody (NBP1-93828) (0)

There are no reviews for FAM211A Antibody (NBP1-93828). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM211A Antibody (NBP1-93828) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM211A Products

Bioinformatics Tool for FAM211A Antibody (NBP1-93828)

Discover related pathways, diseases and genes to FAM211A Antibody (NBP1-93828). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM211A

There are no specific blogs for FAM211A, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM211A Antibody and receive a gift card or discount.


Gene Symbol FAM211A