FAM20A Antibody (2I9B0)

Western Blot: FAM20A Antibody (2I9B0) [NBP3-33384] - Western blot analysis of various lysates, using FAM20A Rabbit mAb at 1:20000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 180s.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2I9B0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

FAM20A Antibody (2I9B0) Summary

• Description: Novus Biologicals Rabbit FAM20A Antibody (2I9B0) (NBP3-33384) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500-600 of human FAM20A.2).
  
  Sequence:
  AIFDFLIGNMDRHHYEMFTKFGDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVLTEPHLLALDR
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: FAM20A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:2000 - 1:20000
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for FAM20A Antibody (2I9B0)

• AIGFS
• DKFZp434F2322
• family with sequence similarity 20, member A
• FP2747
• UNQ9388/PRO34279

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM20A