FAM196A Antibody

Images

 
Immunohistochemistry: FAM196A Antibody [NBP2-48649] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM196A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VTKSTGVQTSPDLKKCYQTFPLDRKKGNLKSLPAADPFKSQNNGFLTDAKEKNEAGPMEEARPCGAGRVHKTTALVFHSNQHMNTVDQPLGVNCTEPCKSP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM196A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM196A Recombinant Protein Antigen (NBP2-48649PEP)

Reactivity Notes

Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM196A Antibody

  • C10orf141
  • Chromosome 10 Open Reading Frame 141
  • Family With Sequence Similarity 196, Member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM196A Antibody (NBP2-48649) (0)

There are no publications for FAM196A Antibody (NBP2-48649).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM196A Antibody (NBP2-48649) (0)

There are no reviews for FAM196A Antibody (NBP2-48649). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM196A Antibody (NBP2-48649) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM196A Products

Bioinformatics Tool for FAM196A Antibody (NBP2-48649)

Discover related pathways, diseases and genes to FAM196A Antibody (NBP2-48649). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM196A

There are no specific blogs for FAM196A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM196A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM196A