FAM195A Antibody


Western Blot: FAM195A Antibody [NBP2-32535] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry: FAM195A Antibody [NBP2-32535] - liver cancer
Immunohistochemistry: FAM195A Antibody [NBP2-32535] - Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemistry: FAM195A Antibody [NBP2-32535] - heart muscle

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

FAM195A Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EESVRFVSEAWQQVQQQLDGGPAGEGGPRPVQYVERTPNPRLQNFVPIDLDEWWAQQFLARITSC
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Control Peptide
FAM195A Protein (NBP2-32535PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Alternate Names for FAM195A Antibody

  • C16orf14
  • c349E10.1
  • Chromosome 16 Open Reading Frame 14
  • Family With Sequence Similarity 195, Member A
  • Protein FAM195A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM195A Antibody (NBP2-32535) (0)

There are no publications for FAM195A Antibody (NBP2-32535).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM195A Antibody (NBP2-32535) (0)

There are no reviews for FAM195A Antibody (NBP2-32535). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM195A Antibody (NBP2-32535) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM195A Antibody Products

FAM195A NBP2-32535

Bioinformatics Tool for FAM195A Antibody (NBP2-32535)

Discover related pathways, diseases and genes to FAM195A Antibody (NBP2-32535). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM195A

There are no specific blogs for FAM195A, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol FAM195A

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-32535 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought