FAM18B2 Antibody


Immunocytochemistry/ Immunofluorescence: FAM18B2 Antibody [NBP2-56573] - Staining of human cell line A-431 shows localization to the Golgi apparatus.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF

Order Details

FAM18B2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLQQDSNDDTEDVSLFDAEEETTNRPRKAK
Specificity of human FAM18B2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Rat 87%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for FAM18B2 Antibody

  • family with sequence similarity 18, member B2
  • hypothetical protein LOC201158
  • MGC8763


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM18B2 Antibody (NBP2-56573) (0)

There are no publications for FAM18B2 Antibody (NBP2-56573).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM18B2 Antibody (NBP2-56573) (0)

There are no reviews for FAM18B2 Antibody (NBP2-56573). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM18B2 Antibody (NBP2-56573) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM18B2 Products

Bioinformatics Tool for FAM18B2 Antibody (NBP2-56573)

Discover related pathways, diseases and genes to FAM18B2 Antibody (NBP2-56573). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM18B2

There are no specific blogs for FAM18B2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM18B2 Antibody and receive a gift card or discount.


Gene Symbol TVP23C