Recombinant Human FAM173B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FAM173B Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 233 of Human LOC134145 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAVYAVATPFVTPALRKVCLPFVPATMKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGYELNPWLVWYSRYRAWREGVHGSAKFYISDLWKVTFSQYSNVVIFGVPQMMLQLEKKLERELEDDARVIACRFPFPHWTPDHVTGEGIDTVWAYDASTFRGREKRPCTSMHFQLPIQA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FAM173B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FAM173B Protein

  • family with sequence similarity 173, member B
  • FLJ20667
  • hypothetical protein LOC134145

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82069
Species: Hu
Applications: WB, IHC, IHC-P
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-31317
Species: Hu
Applications: WB, ICC/IF
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA

Publications for FAM173B Recombinant Protein (H00134145-P01) (0)

There are no publications for FAM173B Recombinant Protein (H00134145-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM173B Recombinant Protein (H00134145-P01) (0)

There are no reviews for FAM173B Recombinant Protein (H00134145-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM173B Recombinant Protein (H00134145-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FAM173B Products

Bioinformatics Tool for FAM173B Recombinant Protein (H00134145-P01)

Discover related pathways, diseases and genes to FAM173B Recombinant Protein (H00134145-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM173B

There are no specific blogs for FAM173B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FAM173B Antibody
NBP2-57443

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FAM173B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM173B