FAM170b Antibody


Immunohistochemistry-Paraffin: FAM170b Antibody [NBP2-13985] - Staining of human esophagus shows strong nuclear positivity in squamous epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FAM170b Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GIREGFSCQIFFEEMLERRRAQGQAHDQQLEEEQSPSDNSECSRPQGEVL SAQQQEKQ
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM170b Protein (NBP2-13985PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM170b Antibody

  • putative protein FAM170B
  • C10orf73
  • family with sequence similarity 170, member B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM170b Antibody (NBP2-13985) (0)

There are no publications for FAM170b Antibody (NBP2-13985).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM170b Antibody (NBP2-13985) (0)

There are no reviews for FAM170b Antibody (NBP2-13985). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FAM170b Antibody (NBP2-13985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM170b Products

Bioinformatics Tool for FAM170b Antibody (NBP2-13985)

Discover related pathways, diseases and genes to FAM170b Antibody (NBP2-13985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM170b

There are no specific blogs for FAM170b, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM170b Antibody and receive a gift card or discount.


Gene Symbol FAM170B