FAM155A Antibody

Western Blot: FAM155A Antibody [NBP1-90982] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining in human cerebral cortex and liver tissues using anti-FAM155A antibody. Corresponding FAM155A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining of human liver shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

FAM155A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NALF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  FAM155A Protein (NBP1-90982PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM155A Antibody

• family with sequence similarity 155, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NALF1