FAM155A Antibody

Images

 
Western Blot: FAM155A Antibody [NBP1-90982] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Orthogonal Strategies: Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining in human cerebral cortex and liver tissues using anti-FAM155A antibody. Corresponding FAM155A RNA-seq data are ...read more
Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: FAM155A Antibody [NBP1-90982] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FAM155A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPL
Specificity
Specificity of human FAM155A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM155A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM155A Antibody

  • family with sequence similarity 155, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM155A Antibody (NBP1-90982) (0)

There are no publications for FAM155A Antibody (NBP1-90982).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM155A Antibody (NBP1-90982) (0)

There are no reviews for FAM155A Antibody (NBP1-90982). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM155A Antibody (NBP1-90982) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FAM155A Products

Bioinformatics Tool for FAM155A Antibody (NBP1-90982)

Discover related pathways, diseases and genes to FAM155A Antibody (NBP1-90982). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM155A

There are no specific blogs for FAM155A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM155A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM155A