![Western Blot: FAM154B Antibody [NBP1-90520] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/FAM154B-Antibody-Western-Blot-NBP1-90520-img0006.jpg "Western Blot: FAM154B Antibody [NBP1-90520] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QGLIGETAKLCRPVHTRVTQNALFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM154B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAM154B |
![Immunocytochemistry/Immunofluorescence: FAM154B Antibody [NBP1-90520] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & the Golgi apparatus.](http://images.novusbio.com/fullsize2/FAM154B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90520-img0009.jpg "Immunocytochemistry/Immunofluorescence: FAM154B Antibody [NBP1-90520] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm & the Golgi apparatus.")
![Immunohistochemistry-Paraffin: FAM154B Antibody [NBP1-90520] - Staining in human fallopian tube and prostate tissues using anti-SAXO2 antibody. Corresponding SAXO2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/FAM154B-Antibody-Immunohistochemistry-Paraffin-NBP1-90520-img0012.jpg "Immunohistochemistry-Paraffin: FAM154B Antibody [NBP1-90520] - Staining in human fallopian tube and prostate tissues using anti-SAXO2 antibody. Corresponding SAXO2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: FAM154B Antibody [NBP1-90520] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize2/FAM154B-Antibody-Immunohistochemistry-Paraffin-NBP1-90520-img0010.jpg "Immunohistochemistry-Paraffin: FAM154B Antibody [NBP1-90520] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: FAM154B Antibody [NBP1-90520] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize2/FAM154B-Antibody-Immunohistochemistry-Paraffin-NBP1-90520-img0011.jpg "Immunohistochemistry-Paraffin: FAM154B Antibody [NBP1-90520] - Staining of human prostate shows low expression as expected.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")