![Western Blot: FAM151A Antibody [NBP2-13983] - Analysis in control (vector only transfected HEK293T lysate) and FAM151A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/FAM151A-Antibody-Western-Blot-NBP2-13983-img0004.jpg "Western Blot: FAM151A Antibody [NBP2-13983] - Analysis in control (vector only transfected HEK293T lysate) and FAM151A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Knockout (KO) Validated Rabbit FAM151A Antibody - BSA Free (NBP2-13983) is a polyclonal antibody validated for use in IHC and WB. Anti-FAM151A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: GTANETGVPIMAHPPTIYSDNTLEQWLDAVLGSSQKGIKLDFKNIKAVGPSLDLLRQLTEEGKVRRPIWINADILKGPNMLISTEVNATQFLALVQEKYPKATLSPGWTTFYMSTSPNRTYTQAMVEKMHELVG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FAM151A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-13983 | Applications | Species |
|---|---|---|
| Findlay AS, McKie L, Keighren M et al. Fam151b, the mouse homologue of C.elegans menorin gene, is essential for retinal function Sci Rep 2020-01-16 [PMID: 31949211] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FAM151A |
![Immunohistochemistry-Paraffin: FAM151A Antibody [NBP2-13983] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/FAM151A-Antibody-Immunohistochemistry-Paraffin-NBP2-13983-img0003.jpg "Immunohistochemistry-Paraffin: FAM151A Antibody [NBP2-13983] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.")
![Western Blot: FAM151A Antibody [NBP2-13983] - Fam151aKO/KO mice were aged to one year to observe whether they exhibit late onset retinal degeneration not picked up on at the 15 week fundal examination by IMPC. Western blot showing loss of Fam151a protein in kidney samples of Fam151aKO/KO mice compared to Fam151a+/+, band at 66 kDa highlighted. Alpha-tubulin used as a loading control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31949211/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/FAM151A-Antibody-Knockout-Validated-NBP2-13983-img0005.jpg "Western Blot: FAM151A Antibody [NBP2-13983] - Fam151aKO/KO mice were aged to one year to observe whether they exhibit late onset retinal degeneration not picked up on at the 15 week fundal examination by IMPC. Western blot showing loss of Fam151a protein in kidney samples of Fam151aKO/KO mice compared to Fam151a+/+, band at 66 kDa highlighted. Alpha-tubulin used as a loading control. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31949211/) licensed under a CC-BY license.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")