FAM131C Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM131C Antibody [NBP2-13981] - Staining of human cell line A-431 shows positivity in nucleoli and mitochondria.
Immunohistochemistry-Paraffin: FAM131C Antibody [NBP2-13981] - Staining of human colon shows strong luminal membranous positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: FAM131C Antibody [NBP2-13981] - Immunofluorescent staining of human cell line A549 shows localization to cytosol & intermediate filaments.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM131C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AEDEHYCCLPDELREARFAAGVAEQFAITEATLSAWSSLDEEELHPENSP QGIVQLQDLESIYLQDSLPSG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM131C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM131C Protein (NBP2-13981PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM131C Antibody

  • C1orf117
  • family with sequence similarity 131, member C
  • FLJ36766
  • hypothetical protein LOC348487
  • RP11-5P18.9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM131C Antibody (NBP2-13981) (0)

There are no publications for FAM131C Antibody (NBP2-13981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM131C Antibody (NBP2-13981) (0)

There are no reviews for FAM131C Antibody (NBP2-13981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM131C Antibody (NBP2-13981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM131C Products

Bioinformatics Tool for FAM131C Antibody (NBP2-13981)

Discover related pathways, diseases and genes to FAM131C Antibody (NBP2-13981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM131C

There are no specific blogs for FAM131C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM131C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM131C