FAM131A Antibody


Western Blot: FAM131A Antibody [NBP1-91167] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: FAM131A Antibody [NBP1-91167] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: FAM131A Antibody [NBP1-91167] - Staining of human rectum shows strong nucleolar positivity in glandular cells.
Western Blot: FAM131A Antibody [NBP1-91167] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

FAM131A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSL
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM131A Protein (NBP1-91167PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM131A Antibody

  • family with sequence similarity 131, member A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM131A Antibody (NBP1-91167) (0)

There are no publications for FAM131A Antibody (NBP1-91167).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM131A Antibody (NBP1-91167) (0)

There are no reviews for FAM131A Antibody (NBP1-91167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM131A Antibody (NBP1-91167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM131A Products

Bioinformatics Tool for FAM131A Antibody (NBP1-91167)

Discover related pathways, diseases and genes to FAM131A Antibody (NBP1-91167). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM131A

There are no specific blogs for FAM131A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM131A Antibody and receive a gift card or discount.


Gene Symbol FAM131A