FAM114A2 Antibody


Western Blot: FAM114A2 Antibody [NBP1-89407] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: FAM114A2 Antibody [NBP1-89407] - Staining of human cell line U-251 MG shows positivity in cytoplasm & vesicles.
Immunohistochemistry-Paraffin: FAM114A2 Antibody [NBP1-89407] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus duct cells.
Western Blot: FAM114A2 Antibody [NBP1-89407] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

FAM114A2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:SATVATVGQGISNVIEKAETSLGIPSPSEISTEVKYVAGETNAKENENSSPVAGAFGVFSTISTAVQSTGKSVISG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
FAM114A2 Protein (NBP1-89407PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Alternate Names for FAM114A2 Antibody

  • C5orf3
  • chromosome 5 open reading frame 3
  • family with sequence similarity 114, member A2,133K02
  • hypothetical protein LOC10827


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM114A2 Antibody (NBP1-89407) (0)

There are no publications for FAM114A2 Antibody (NBP1-89407).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM114A2 Antibody (NBP1-89407) (0)

There are no reviews for FAM114A2 Antibody (NBP1-89407). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM114A2 Antibody (NBP1-89407) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM114A2 Antibody Products

Related Products by Gene

Bioinformatics Tool for FAM114A2 Antibody (NBP1-89407)

Discover related pathways, diseases and genes to FAM114A2 Antibody (NBP1-89407). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM114A2

There are no specific blogs for FAM114A2, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol FAM114A2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89407 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought