FAM113A Antibody


Immunocytochemistry/ Immunofluorescence: FAM113A Antibody [NBP2-13976] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: FAM113A Antibody [NBP2-13976] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

FAM113A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LPPPIPGPNPHGQHWGPVVHRGMPRYVPNSPYHVRRMGGPCRQRLRHSER LIHTYKLDRRPPAHS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM113A Protein (NBP2-13976PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM113A Antibody

  • bA12M19.1
  • C20orf81
  • chromosome 20 open reading frame 81
  • DKFZp547L054
  • family with sequence similarity 113, member A
  • FLJ22376
  • hypothetical protein LOC64773
  • Sarcoma antigen NY-SAR-23


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM113A Antibody (NBP2-13976) (0)

There are no publications for FAM113A Antibody (NBP2-13976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM113A Antibody (NBP2-13976) (0)

There are no reviews for FAM113A Antibody (NBP2-13976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM113A Antibody (NBP2-13976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAM113A Products

Bioinformatics Tool for FAM113A Antibody (NBP2-13976)

Discover related pathways, diseases and genes to FAM113A Antibody (NBP2-13976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM113A

There are no specific blogs for FAM113A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM113A Antibody and receive a gift card or discount.


Gene Symbol PCED1A