FAM105B/OTULIN Antibody

Images

 
Orthogonal Strategies: Western Blot: FAM105B/OTULIN Antibody [NBP2-14722] - Analysis in human cell lines HeLa and MCF-7 using anti-OTULIN antibody. Corresponding OTULIN RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: FAM105B/OTULIN Antibody [NBP2-14722] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & mitochondria.
Immunohistochemistry-Paraffin: FAM105B/OTULIN Antibody [NBP2-14722] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FAM105B/OTULIN Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTULIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM105B/OTULIN Protein (NBP2-14722PEP)
Publications
Read Publication using
NBP2-14722 in the following applications:

  • IP
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%). Human reactivity reported in scientific literature (PMID: 26235645).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM105B/OTULIN Antibody

  • FAM105B family with sequence similarity 105, member B
  • FAM105B
  • OTULIN

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM105B/OTULIN Antibody (NBP2-14722)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for FAM105B/OTULIN Antibody (NBP2-14722) (0)

There are no reviews for FAM105B/OTULIN Antibody (NBP2-14722). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM105B/OTULIN Antibody (NBP2-14722) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM105B/OTULIN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTULIN