![Western Blot: FAM105B/OTULIN Antibody [NBP2-14722] - Analysis in human cell lines HeLa and MCF-7 using anti-OTULIN antibody. Corresponding OTULIN RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.](http://images.novusbio.com/fullsize/FAM105B-OTULIN-Antibody-Western-Blot-NBP2-14722-img0009.jpg "Western Blot: FAM105B/OTULIN Antibody [NBP2-14722] - Analysis in human cell lines HeLa and MCF-7 using anti-OTULIN antibody. Corresponding OTULIN RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit FAM105B/OTULIN Antibody - BSA Free (NBP2-14722) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and IP. Anti-FAM105B/OTULIN Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: DEIEKEKELLIHERGASEPRLSVAPEMDIMDYCKKEWRGNTQKATCMKMGYEEVSQKFTSIRRVRGDNYCALRATLFQAMSQAVGLPPWLQDPELMLLP |
| Predicted Species | Mouse (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OTULIN |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-14722 | Applications | Species |
|---|---|---|
| Grou CP, Pinto MP, Mendes AV et al. The de novo synthesis of ubiquitin: identification of deubiquitinases acting on ubiquitin precursors. Sci Rep 2015-08-03 [PMID: 26235645] (IP, Human) | IP | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OTULIN |
![Immunocytochemistry/Immunofluorescence: FAM105B/OTULIN Antibody [NBP2-14722] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & mitochondria.](http://images.novusbio.com/fullsize/FAM105B-OTULIN-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14722-img0005.jpg "Immunocytochemistry/Immunofluorescence: FAM105B/OTULIN Antibody [NBP2-14722] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & mitochondria.")
![Immunohistochemistry-Paraffin: FAM105B/OTULIN Antibody [NBP2-14722] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/FAM105B-OTULIN-Antibody-Immunohistochemistry-Paraffin-NBP2-14722-img0001.jpg "Immunohistochemistry-Paraffin: FAM105B/OTULIN Antibody [NBP2-14722] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")