FADS6 Antibody


Immunohistochemistry: FADS6 Antibody [NBP2-14490] - Staining of human fallopian tube shows strong cytoplasmic positivity in subset of glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

FADS6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GHSIISCHVEHHLFPRLSDNMCLKVKPVVSQFLREKQLPYNEDSYLARFQ LFLRRYEEFMVQAPPITELV
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FADS6 Protein (NBP2-14490PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FADS6 Antibody

  • FADS6 fatty acid desaturase domain family, member 6
  • FP18279


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FADS6 Antibody (NBP2-14490) (0)

There are no publications for FADS6 Antibody (NBP2-14490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FADS6 Antibody (NBP2-14490) (0)

There are no reviews for FADS6 Antibody (NBP2-14490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FADS6 Antibody (NBP2-14490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FADS6 Products

Array NBP2-14490

Bioinformatics Tool for FADS6 Antibody (NBP2-14490)

Discover related pathways, diseases and genes to FADS6 Antibody (NBP2-14490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FADS6

There are no specific blogs for FADS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FADS6 Antibody and receive a gift card or discount.


Gene Symbol FADS6