EVI5L Antibody

Images

 
Western Blot: EVI5L Antibody [NBP2-54925] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: EVI5L Antibody [NBP2-54925] - Staining of human cell line U-2 OS shows localization to nuclear bodies.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EVI5L Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRKLVVGELQDELMSVRLREAQALAEGRELRQRVVELETQDHIHRNLLNRVEA
Specificity
Specificity of human EVI5L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EVI5L
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EVI5L Recombinant Protein Antigen (NBP2-54925PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for EVI5L Antibody

  • Ecotropic viral integration site 5-like protein
  • ecotropic viral integration site 5-like
  • EVI5-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EVI5L Antibody (NBP2-54925) (0)

There are no publications for EVI5L Antibody (NBP2-54925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EVI5L Antibody (NBP2-54925) (0)

There are no reviews for EVI5L Antibody (NBP2-54925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EVI5L Antibody (NBP2-54925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for EVI5L Antibody (NBP2-54925)

Discover related pathways, diseases and genes to EVI5L Antibody (NBP2-54925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for EVI5L Antibody (NBP2-54925)

Find related products by research area.

Blogs on EVI5L

There are no specific blogs for EVI5L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EVI5L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EVI5L