![Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining in human cerebral cortex and pancreas tissues using anti-EFR3A antibody. Corresponding EFR3A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Immunohistochemistry-Paraffin-NBP1-81539-img0014.jpg "Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining in human cerebral cortex and pancreas tissues using anti-EFR3A antibody. Corresponding EFR3A RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPDVADLKIKREKICRQDTSFMK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EFR3A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EFR3A |
![Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-EFR3A antibody NBP1-81539 (A) shows similar protein distribution across tissues to independent antibody NBP1-81540 (B).](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Immunohistochemistry-Paraffin-NBP1-81539-img0017.jpg "Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-EFR3A antibody NBP1-81539 (A) shows similar protein distribution across tissues to independent antibody NBP1-81540 (B).")
![Western Blot: EFR3A Antibody [NBP1-81539] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Western-Blot-NBP1-81539-img0016.jpg "Western Blot: EFR3A Antibody [NBP1-81539] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human cerebral cortex using Anti-EFR3A antibody NBP1-81539.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Immunohistochemistry-Paraffin-NBP1-81539-img0022.jpg "Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human cerebral cortex using Anti-EFR3A antibody NBP1-81539.")
![Western Blot: EFR3A Antibody [NBP1-81539] - Analysis in human cell line HDLM-2.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Western-Blot-NBP1-81539-img0008.jpg "Western Blot: EFR3A Antibody [NBP1-81539] - Analysis in human cell line HDLM-2.")
![Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Immunohistochemistry-Paraffin-NBP1-81539-img0012.jpg "Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Immunohistochemistry-Paraffin-NBP1-81539-img0013.jpg "Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human testis.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Immunohistochemistry-Paraffin-NBP1-81539-img0019.jpg "Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human testis.")
![Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human kidney.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Immunohistochemistry-Paraffin-NBP1-81539-img0020.jpg "Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human lymph node.](http://images.novusbio.com/fullsize2/EFR3A-Antibody-Immunohistochemistry-Paraffin-NBP1-81539-img0021.jpg "Immunohistochemistry-Paraffin: EFR3A Antibody [NBP1-81539] - Staining of human lymph node.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")