EFCAB4A Antibody

Western Blot: EFCAB4A Antibody [NBP1-91863] - Analysis in control (vector only transfected HEK293T lysate) and EFCAB4A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: EFCAB4A Antibody [NBP1-91863] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

EFCAB4A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LEAVFESLDQAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CRACR2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EFCAB4A Protein (NBP1-91863PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EFCAB4A Antibody

• Calcium release-activated calcium channel regulator 2B
• CRAC channel regulator 2B
• CRACR2B
• EF-hand calcium binding domain 4A
• EF-hand calcium-binding domain-containing protein 4A
• FLJ46033
• MGC45840
• MGC88858

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CRACR2B