EFCAB3 Antibody - BSA Free

Western Blot: EFCAB3 Antibody [NBP2-48861] - Analysis in control (vector only transfected HEK293T lysate) and EFCAB3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: EFCAB3 Antibody [NBP2-48861] - Staining of human testis shows cytoplasmic and nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EFCAB3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ADATTIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGIDSRNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EFCAB3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EFCAB3 Recombinant Protein Antigen (NBP2-48861PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EFCAB3 Antibody - BSA Free

• EF-hand calcium binding domain 3
• EF-hand calcium-binding domain-containing protein 3
• FLJ25818
• MGC126801
• MGC126827

Background

EFCAB3, also known as EF-hand calcium-binding domain-containing protein 3, has a 56 kDa 490 amino acid isoform and a shorter 50 kDa 438 amino acid isoform. EFCAB3 is also known as FLJ258181 and EF-Hand Calcium-Binding Domain-Containing Protein 3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EFCAB3